PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Manes.17G041900.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Crotonoideae; Manihoteae; Manihot
Family NAC
Protein Properties Length: 363aa    MW: 40064.2 Da    PI: 9.4092
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Manes.17G041900.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM1713.8e-53171441128
                  NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdk 90 
                          lppGfrFhPtdeelvv+yLkkk+++ +l++  +i++vd+yk++Pw+Lp+k + +ekewyfFs+rd+ky++g r+nra++sgyWkatg dk
  Manes.17G041900.1.p  17 LPPGFRFHPTDEELVVHYLKKKAASAPLPV-AIISDVDLYKFDPWELPSKSTFGEKEWYFFSPRDRKYPNGARPNRAATSGYWKATGIDK 105
                          79****************************.88***************8888899*********************************** PP

                  NAM  91 evlsk.kgelvglkktLvfykgrapkgektdWvmheyrl 128
                          ++l++ ++++vg+kk Lvfy g+ pkg kt+W+mheyrl
  Manes.17G041900.1.p 106 PILTSdGTRKVGVKKALVFYGGKPPKGIKTNWIMHEYRL 144
                          ***9967889***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019415.36E-6413180IPR003441NAC domain
PROSITE profilePS5100561.81717180IPR003441NAC domain
PfamPF023651.4E-2718144IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 363 aa     Download sequence    Send to blast
MESTDSSSAS HHLPIQLPPG FRFHPTDEEL VVHYLKKKAA SAPLPVAIIS DVDLYKFDPW  60
ELPSKSTFGE KEWYFFSPRD RKYPNGARPN RAATSGYWKA TGIDKPILTS DGTRKVGVKK  120
ALVFYGGKPP KGIKTNWIMH EYRLVDNMNN SASKLPGVAS TTQKGSLRLD DWVLCRIYKK  180
NNSQKPTDRD KEDSMAGLFC TLPLMHPKPS AASASASKPT SFVSVIEDEE NFFEGILTGK  240
IHGMQNSSKI SHHHQLPCSS PNPNISTIHF ASTSNNTLPV KNLLPSQYWD EAAPAGSSPM  300
AASSGKRFHG DLNSCTTATD DNSSFVSLLR QLPQGTPFHP NTFLGDNVLR QQFQLPSMNW  360
NT*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A8e-741518315168NO APICAL MERISTEM PROTEIN
1ut4_B8e-741518315168NO APICAL MERISTEM PROTEIN
1ut7_A8e-741518315168NO APICAL MERISTEM PROTEIN
1ut7_B8e-741518315168NO APICAL MERISTEM PROTEIN
3swm_A9e-741518318171NAC domain-containing protein 19
3swm_B9e-741518318171NAC domain-containing protein 19
3swm_C9e-741518318171NAC domain-containing protein 19
3swm_D9e-741518318171NAC domain-containing protein 19
3swp_A9e-741518318171NAC domain-containing protein 19
3swp_B9e-741518318171NAC domain-containing protein 19
3swp_C9e-741518318171NAC domain-containing protein 19
3swp_D9e-741518318171NAC domain-containing protein 19
4dul_A8e-741518315168NAC domain-containing protein 19
4dul_B8e-741518315168NAC domain-containing protein 19
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKR6051540.0KR605154.1 Manihot esculenta NAC transcription factors 16 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012091551.10.0PREDICTED: NAC transcription factor 25 isoform X1
SwissprotQ8GY421e-108NAC25_ARATH; NAC transcription factor 25
SwissprotQ9LD441e-108NAC56_ARATH; NAC transcription factor 56
TrEMBLA0A0M4FSE60.0A0A0M4FSE6_MANES; NAC transcription factors 16
STRINGPOPTR_0004s03820.11e-156(Populus trichocarpa)
STRINGPOPTR_0011s04650.11e-156(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF16233498
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G15510.11e-103NAC domain containing protein 2
Publications ? help Back to Top
  1. Hu W, et al.
    Genome-Wide Identification and Expression Analysis of the NAC Transcription Factor Family in Cassava.
    PLoS ONE, 2015. 10(8): p. e0136993
    [PMID:26317631]